
LL-37 5mg
LL-37 5mg is supplied as a research-grade material for laboratory and analytical use only. Batch-specific identity, purity and release data are documented on the Certificate of Analysis.
For research use only — not for human consumption. This material is supplied strictly for laboratory and analytical use by qualified researchers.
Batch Certificate of Analysis available when issued.
Storage instructions
Store sealed material under the conditions stated on the product label and batch Certificate of Analysis.
Technical specification
- Product code
- LL37-5mg
- Format
- 5mg vial
- Batch number
- Assigned at dispatch
- Expiry date
- See vial label
- Molecular formula
- C205H340N60O53
- Molecular weight
- 4493.3 g/mol
- Sequence
- LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES
Analytical documentation
Identity and purity are determined by reverse-phase HPLC with UV detection and confirmed by electrospray mass spectrometry. Water content is determined by Karl Fischer titration and residual solvents by headspace GC.
Compound stability data
Stability was assessed on the lyophilised material held at 2–8°C over the documented shelf life, with no significant change in the chromatographic impurity profile. Full stability datasets are available to institutional purchasers on request.
This compound is supplied for use in laboratory research settings by qualified researchers. It is not a medicinal product, has not been evaluated by the MHRA, and is not for human or veterinary use.
