For research use only — not for human consumption

Sealed research vial for LL37-5mg
LL37-5mg

LL-37 5mg

≥98%Batch Assigned at dispatchExpiry See vial label

LL-37 5mg is supplied as a research-grade material for laboratory and analytical use only. Batch-specific identity, purity and release data are documented on the Certificate of Analysis.

£64.00

For research use only — not for human consumption. This material is supplied strictly for laboratory and analytical use by qualified researchers.

Batch Certificate of Analysis available when issued.

Storage instructions

Store sealed material under the conditions stated on the product label and batch Certificate of Analysis.

Technical specification

Product code
LL37-5mg
Format
5mg vial
Batch number
Assigned at dispatch
Expiry date
See vial label
Molecular formula
C205H340N60O53
Molecular weight
4493.3 g/mol
Sequence
[LL-37, 37 aa]

Analytical documentation

Identity and purity are determined by reverse-phase HPLC with UV detection and confirmed by electrospray mass spectrometry. Water content is determined by Karl Fischer titration and residual solvents by headspace GC.

Compound stability data

Stability was assessed on the lyophilised material held at 2–8°C over the documented shelf life, with no significant change in the chromatographic impurity profile. Full stability datasets are available to institutional purchasers on request.

This compound is supplied for use in laboratory research settings by qualified researchers. It is not a medicinal product, has not been evaluated by the MHRA, and is not for human or veterinary use.